Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OLAH Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | OLAH |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
OLAH Polyclonal specifically detects OLAH in Human samples. It is validated for Western Blot.Specifications
OLAH | |
Polyclonal | |
Rabbit | |
Q9NV23 | |
55301 | |
Synthetic peptides corresponding to OLAH(oleoyl-ACP hydrolase) The peptide sequence was selected from the N terminal of OLAH. Peptide sequence MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
EC 3.1.2.14, FLJ11106, medium chain, MGC51852, oleoyl-ACP hydrolaseAURA1, SAST, THEDC1, thioesterase domain containing 1, Thioesterase II | |
OLAH | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title