Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Olfactory receptor 476 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310272100UL
Description
Olfactory receptor 476 Polyclonal specifically detects Olfactory receptor 476 in Mouse samples. It is validated for Western Blot.Specifications
| Olfactory receptor 476 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 258926 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| The immunogen is a synthetic peptide directed towards the C terminal region of mouse Olfactory receptor 476 (NP_667135.1). Peptide sequence ITFIYVMPKSNYSTAQNKILSVFYTVVIPMLNPLIYSLRNRDVKEALRKA | |
| 100 μg | |
| Primary | |
| Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction