Learn More
Olfactory receptor 484 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Shop All R&D Systems Products

Description
Specifications
Specifications
| Antigen | Olfactory receptor 484 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse Olfactory receptor 484 (NP_666710.1). Peptide sequence KSRYSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEIKGALRRHLGKKIFSQ |
| Purification Method | Affinity purified |
| Quantity | 100 μg |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.