Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

OLFML2B Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15954720UL

 View more versions of this product

Catalog No. NBP15954720


Only null left
Add to Cart

Description

Description

OLFML2B Polyclonal specifically detects OLFML2B in Human samples. It is validated for Western Blot.
Specifications

Specifications

OLFML2B
Polyclonal
Western Blot 0.2-1 ug/ml
Q68BL8
OLFML2B
Synthetic peptides corresponding to OLFML2B(olfactomedin-like 2B) The peptide sequence was selected from the N terminal of human OLFML2B. Peptide sequence EEVSKNLTKENEQIKEDMEEIRTEMNKRGKENCSENILDSMPDIRSALQR.
Affinity Purified
RUO
25903
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
DKFZP586L151, MGC51337, olfactomedin-like 2B, olfactomedin-like protein 2B, photomedin-2, RP11-227F8.1
Rabbit
84 kDa
20 μL
Primary
Human
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.