Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. OLFML2B Antibody, Novus Biologicals™

OLFML2B Antibody, Novus Biologicals™
SDP

Catalog No. NBP15954720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15954720 20 μL
NBP159547 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15954720 Supplier Novus Biologicals Supplier No. NBP15954720UL

Description

Rabbit Polyclonal Antibody

OLFML2B Polyclonal specifically detects OLFML2B in Human samples. It is validated for Western Blot.

Specifications

Antigen OLFML2B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q68BL8
Gene Alias DKFZP586L151, MGC51337, olfactomedin-like 2B, olfactomedin-like protein 2B, photomedin-2, RP11-227F8.1
Gene Symbols OLFML2B
Host Species Rabbit
Immunogen Synthetic peptides corresponding to OLFML2B(olfactomedin-like 2B) The peptide sequence was selected from the N terminal of human OLFML2B. Peptide sequence EEVSKNLTKENEQIKEDMEEIRTEMNKRGKENCSENILDSMPDIRSALQR.
Molecular Weight of Antigen 84 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 25903
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.