Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OLFML2B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | OLFML2B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15954720
|
Novus Biologicals
NBP15954720UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP159547
|
Novus Biologicals
NBP159547 |
100 μL |
Each for $487.50
|
|
|||||
Description
OLFML2B Polyclonal specifically detects OLFML2B in Human samples. It is validated for Western Blot.Specifications
| OLFML2B | |
| Polyclonal | |
| Rabbit | |
| Q68BL8 | |
| 25903 | |
| Synthetic peptides corresponding to OLFML2B(olfactomedin-like 2B) The peptide sequence was selected from the N terminal of human OLFML2B. Peptide sequence EEVSKNLTKENEQIKEDMEEIRTEMNKRGKENCSENILDSMPDIRSALQR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZP586L151, MGC51337, olfactomedin-like 2B, olfactomedin-like protein 2B, photomedin-2, RP11-227F8.1 | |
| OLFML2B | |
| IgG | |
| 84 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title