OMA1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP23097125UL

Catalog No. NB397635

Description

OMA1 Polyclonal specifically detects OMA1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: OMA1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q96E52
• Gene Symbols: OMA1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 2010001O09Rik, DAB1, EC 3.4.24.-, metalloprotease related protein 1, Metalloprotease-related protein 1, MPRP1, MPRP-1mitochondrial, OMA1 homolog, zinc metallopeptidase (S. cerevisiae), overlapping activity with M-AAA protease, YKR087C, ZMPOMA1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 115209
• Target Species: Human
• Isotype: IgG

For Research Use Only