Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Oncomodulin/OCM2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Oncomodulin/OCM2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. p-7249052 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB170296 25 μg
NB170295 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB170296 Supplier Novus Biologicals Supplier No. NBP31761025UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Oncomodulin/OCM2 Polyclonal antibody specifically detects Oncomodulin/OCM2 in Human samples. It is validated for Immunofluorescence

Specifications

Antigen Oncomodulin/OCM2
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias OCM2, oncomodulin 2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: ASQVKDVFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADNDG
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4951
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.