OPA3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP168964

Catalog No. NBP168964

Description

OPA3 Polyclonal specifically detects OPA3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: OPA3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: OPA3
• Immunogen: Synthetic peptides corresponding to OPA3 (optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia)) The peptide sequence was selected from the C terminal of OPA3. Peptide sequence SCLMLEYWRHQLQQRRKEKERRVAREALRGEVGHLGLALEELQAQVQATS The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Pig: 82%.
• Target Species: Human, Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: FLJ22187, FLJ25932, MGA3Optic atrophy 3 (Iraqi-Jewish 'optic atrophy plus'), MGC75494, optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia), optic atrophy 3 protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 20 kDa
• Quantity: 100 μL
• Research Discipline: Vision
• Gene ID (Entrez): 80207
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.