Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ OPN1SW (Human) Recombinant Protein

Catalog No. 89999279
Click to view available options
Quantity:
2 μg

Human OPN1SW full-length ORF (AAI56720.1) recombinant protein without tag.

  • Sequence: MRKMSEEEFYLFKNISSVGPWDGPQYHIAPVWAFYLQAAFMGTVFLIGFPLNAMVLVATLRYKKLRQPLNYILVNVSFGGFLLCIFSVFPVFVASCNGYFVFGRHVCALEGFLGTVAGLVTGWSLAFLAFERYIVICKPFGNFRFSSKHALTVVLATWTIGIGVSIPPFFGWSRFIPEGLQCSCGPDWYTVGTKYRSESYTWFLFIFCFIVPLSLICFSYTQLLRALKAVAAQQQESATTQKAEREVSRMVVVMVGSFCVCYVPYAAFAMYMVNNRNHGLDLRLVTIPSFFSKSACIYNPIIYCFMNKQFQACIMKMVCGKAMTDESDTCSSQKTEVSTVSSTQVGPN

Specifications

Accession Number AAI56720.1
Gene ID (Entrez) 611
Name opsin 1 (cone pigments), short-wave-sensitive
Preparation Method Wheat germ expression system
Quantity 2 μg
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias BCP, BOP, CBT
Gene Symbol OPN1SW
Species Wheat Germ (in vitro)
Buffer 25 mM Tris-HCl of pH 8.0 containing 2% glycerol
Form Liquid
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.