Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Opticin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Opticin |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Opticin Polyclonal specifically detects Opticin in Human samples. It is validated for Western Blot.Specifications
Opticin | |
Polyclonal | |
Rabbit | |
Q9UBM4 | |
26254 | |
Synthetic peptide directed towards the C terminal of human OPTCThe immunogen for this antibody is OPTC (NP_055174). Peptide sequence LSDNLLDSIPGPLPLSLRSVHLQNNLIETMQRDVFCDPEEHKHTRRQLED. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
oculoglycan, OPT, opticin | |
OPTC | |
IgG | |
37 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title