Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Optineurin Monoclonal Antibody (3D8), Invitrogen™

Mouse Monoclonal Antibody

Supplier:  Thermo Scientific MA549177

Encompass

Catalog No. PIMA549177


Add to Cart

Description

Description

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Human Optineurin shares 82% amino acid (aa) sequence identity with both mouse and rat Optineurin.

Optineurin Monoclonal antibody specifically detects Optineurin in Human, Mouse, Non-human Primate, Rat samples. It is validated for Flow Cytometry, Western Blot
TRUSTED_SUSTAINABILITY
Specifications

Specifications

Optineurin
Monoclonal
500 μg/mL
PBS with 4MG trehalose and 0.05MG sodium azide
P21279, P50148, P82471
Mouse
Antigen affinity chromatography
RUO
14682, 2776, 81666
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
IgG2b
Flow Cytometry, Western Blot
3D8
Unconjugated
GNAQ
14.7K-interacting protein 2; 4930441O07Rik; Ag9 C5; ALS12; E3-14.7K-interacting protein; FIP 2; FIP2; FIP-2; FIP-2-like protein; GLC1E; HIP 7; HIP7; HIP-7; Huntingtin interacting protein L; huntingtin yeast partner L; Huntingtin-interacting protein 7; huntingtin-interacting protein L; HYPL; NEMO-related protein; NRP; Optic neuropathy-inducing protein; optineurin; Optn; TFIIIA IntP; TFIIIA-IntP; transcription factor IIIA-interacting protein; transcrption factor IIIA-interacting protein; tumor necrosis factor alpha-inducible cellular protein containing leucine zipper domains; Uban
A synthetic peptide corresponding to a sequence at the N-terminus of human GNAQ (102-138aa KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND).
100 μg
Primary
Human, Mouse, Non-human Primate, Rat
Lyophilized
Product Suggestions

Product Suggestions

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit