Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR11H12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | OR11H12 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
OR11H12 Polyclonal specifically detects OR11H12 in Human samples. It is validated for Western Blot.Specifications
OR11H12 | |
Polyclonal | |
Rabbit | |
olfactory receptor 11H12, olfactory receptor, family 11, subfamily H, member 12 | |
OR11H12 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
440153 | |
Synthetic peptides corresponding to OR11H12(olfactory receptor, family 11, subfamily H, member 12) The peptide sequence was selected from the N terminal of OR11H12. Peptide sequence CPLTLQVTGLMNVSEPNSSFAFVNEFILQGFTCEWTIQIFLFSLFTTTYA. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title