Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

OR13C9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	OR13C9
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP179986 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP179986	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

OR13C9 Polyclonal specifically detects OR13C9 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	OR13C9
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene Alias	olfactory receptor, family 13, subfamily C, member 9, OR37L
Gene Symbols	OR13C9
Isotype	IgG
Purification Method	Protein A purified

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Host Species	Rabbit
Gene Accession No.	NP_001001956
Gene ID (Entrez)	286362
Immunogen	Synthetic peptide directed towards the middle region of human OR13C9. Peptide sequence IFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLR.
Primary or Secondary	Primary
Molecular Weight of Antigen	36 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

OR13C9 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents