Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR2A25 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | OR2A25 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
OR2A25 Polyclonal specifically detects OR2A25 in Human samples. It is validated for Western Blot.Specifications
| OR2A25 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| olfactory receptor 2A25, Olfactory receptor 2A27, olfactory receptor, family 2, subfamily A, member 24 pseudogene, olfactory receptor, family 2, subfamily A, member 25, olfactory receptor, family 2, subfamily A, member 25 pseudogene, olfactory receptor, family 2, subfamily A, member 27, OR2A24P, OR2A25P, OR2A27 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR2A25 (NP_001004488). Peptide sequence LCVVGLFYGTAIIMYVEPQYESPKEQKKYLLLFHSLFNPMLNPLIYSLRN | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 392138 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title