Learn More
Description
Specifications
Specifications
| Antigen | OR2A25 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | olfactory receptor 2A25, Olfactory receptor 2A27, olfactory receptor, family 2, subfamily A, member 24 pseudogene, olfactory receptor, family 2, subfamily A, member 25, olfactory receptor, family 2, subfamily A, member 25 pseudogene, olfactory receptor, family 2, subfamily A, member 27, OR2A24P, OR2A25P, OR2A27 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR2A25 (NP_001004488). Peptide sequence IIMYVEPQYESPKEQKKYLLLFHSLFNPMLNPLIYSLRNKEVQGTLKRML |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
