OR2A5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP168968

Catalog No. NBP168968

Description

OR2A5 Polyclonal specifically detects OR2A5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: OR2A5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Olfactory receptor 2A26, Olfactory receptor 2A8, Olfactory receptor 7-138/7-141, olfactory receptor, family 2, subfamily A, member 11 pseudogene, olfactory receptor, family 2, subfamily A, member 26, olfactory receptor, family 2, subfamily A, member 5, olfactory receptor, family 2, subfamily A, member 8, OR2A26, OR2A8, OR7-138OR2A11P, OR7-141olfactory receptor 2A5
• Host Species: Rabbit
• Molecular Weight of Antigen: 35 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96R48
• Gene Symbols: OR2A5
• Immunogen: Synthetic peptides corresponding to OR2A5 (olfactory receptor, family 2, subfamily A, member 5) The peptide sequence was selected from the C terminal of OR2A5. Peptide sequence ILAAILRIQSGEGRRKAFSTCSSHLCMVGLFFGSAIVMYMAPKSRHPEEQ.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 393046
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG