Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR2A5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | OR2A5 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
OR2A5 Polyclonal specifically detects OR2A5 in Human samples. It is validated for Western Blot.Specifications
OR2A5 | |
Polyclonal | |
Rabbit | |
Q96R48 | |
393046 | |
Synthetic peptides corresponding to OR2A5 (olfactory receptor, family 2, subfamily A, member 5) The peptide sequence was selected from the C terminal of OR2A5. Peptide sequence ILAAILRIQSGEGRRKAFSTCSSHLCMVGLFFGSAIVMYMAPKSRHPEEQ. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Olfactory receptor 2A26, Olfactory receptor 2A8, Olfactory receptor 7-138/7-141, olfactory receptor, family 2, subfamily A, member 11 pseudogene, olfactory receptor, family 2, subfamily A, member 26, olfactory receptor, family 2, subfamily A, member 5, olfactory receptor, family 2, subfamily A, member 8, OR2A26, OR2A8, OR7-138OR2A11P, OR7-141olfactory receptor 2A5 | |
OR2A5 | |
IgG | |
35 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title