OR2AT4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159861

Catalog No. NBP159861

Description

OR2AT4 Polyclonal specifically detects OR2AT4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: OR2AT4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: olfactory receptor 2AT4, Olfactory receptor OR11-265, olfactory receptor OR11-265 pseudogene, olfactory receptor, family 2, subfamily AT, member 4, OR11-265
• Host Species: Rabbit
• Molecular Weight of Antigen: 35 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Equine 77%, Mouse 85%, Rabbit: 77%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: A6NND4
• Gene Symbols: OR2AT4
• Immunogen: Synthetic peptides corresponding to OR2AT4(olfactory receptor, family 2, subfamily AT, member 4) Antibody(against the N terminal of OR2AT4. Peptide sequence MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALI.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 341152
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.