Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

OR2AT4 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159861

 View more versions of this product

Catalog No. NBP159861


Only null left
Add to Cart

Description

Description

OR2AT4 Polyclonal specifically detects OR2AT4 in Human samples. It is validated for Western Blot.
Specifications

Specifications

OR2AT4
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
olfactory receptor 2AT4, Olfactory receptor OR11-265, olfactory receptor OR11-265 pseudogene, olfactory receptor, family 2, subfamily AT, member 4, OR11-265
Rabbit
35 kDa
100 μL
Primary
Expected identity based on immunogen sequence: Equine 77%, Mouse 85%, Rabbit: 77%.
Human, Mouse, Rat, Pig, Bovine, Equine, Guinea Pig, Rabbit
IgG
Western Blot
0.5 mg/ml
Western Blot 1.0 ug/ml
A6NND4
OR2AT4
Synthetic peptides corresponding to OR2AT4(olfactory receptor, family 2, subfamily AT, member 4) Antibody(against the N terminal of OR2AT4. Peptide sequence MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALI.
Affinity purified
RUO
341152
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.