OR2F1 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP309391100UL

Catalog No. NB123683

Description

OR2F1 Polyclonal specifically detects OR2F1 in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: OR2F1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: OLF3OR2F3P, olfactory receptor 2F1, Olfactory receptor 2F3, Olfactory receptor 2F4, Olfactory receptor 2F5, olfactory receptor OR7-7, olfactory receptor, family 2, subfamily F, member 1, olfactory receptor, family 2, subfamily F, member 3, olfactory receptor, family 2, subfamily F, member 4, olfactory receptor, family 2, subfamily F, member 5, Olfactory receptor-like protein OLF3, OR14-60, OR2F3, OR2F4, OR2F5, OR7-139, OR7-140
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat OR2F1 (NP_001000976). Peptide sequence IISTILKIQSKEGRKKAFHTCASHLTVVALCYGMAIFTYIQPHSSPSVLQ
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Rat
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 26211
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.