OR2H1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169053

Catalog No. NBP169053

Description

OR2H1 Polyclonal specifically detects OR2H1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: OR2H1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: family 2, subfamily H, member 6, Hs6M1-16, Olfactory receptor 2H6, olfactory receptor, family 2, subfamily H, member 1,6M1-16, olfactory receptor, family 2, subfamily H, member 8, OLFR42A-9004-14, OR2H8, OR6-2HS6M1-16
• Host Species: Rabbit
• Molecular Weight of Antigen: 35 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Porcine: 86%; Bovine: 86%; Guinea pig: 86%; Canine: 85%; Equine: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9GZK4
• Gene Symbols: OR2H1
• Immunogen: Synthetic peptides corresponding to OR2H1 (olfactory receptor, family 2, subfamily H, member 1) The peptide sequence was selected from the C terminal of OR2H1. Peptide sequence IAVYLQPKNPYAQGRGKFFGLFYAVGTPSLNPLVYTLRNKEIKRALRRLL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 26716
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.