Learn More
Description
Specifications
Specifications
| Antigen | OR2H2 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | FAT11, Hs6M1-12, MGC126732, MGC138381, Olfactory receptor 2, olfactory receptor 2H2, Olfactory receptor 2H3, olfactory receptor OR6-36, olfactory receptor, family 2, subfamily H, member 2, olfactory receptor, family 2, subfamily H, member 3, Olfactory receptor-like protein FAT11, OLFR2OLFR42B, OR2H3dJ271M21.2 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse OLFR90 (NP_009091.3). Peptide sequence LQPKNPYAQERGKFFGLFYAVGTPSLNPLIYTLRNKEVTRAFRRLLGKEM |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
