Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR2H2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309987100UL
Description
OR2H2 Polyclonal specifically detects OR2H2 in Mouse samples. It is validated for Western Blot.Specifications
OR2H2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
FAT11, Hs6M1-12, MGC126732, MGC138381, Olfactory receptor 2, olfactory receptor 2H2, Olfactory receptor 2H3, olfactory receptor OR6-36, olfactory receptor, family 2, subfamily H, member 2, olfactory receptor, family 2, subfamily H, member 3, Olfactory receptor-like protein FAT11, OLFR2OLFR42B, OR2H3dJ271M21.2 | |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse OLFR90 (NP_009091.3). Peptide sequence LQPKNPYAQERGKFFGLFYAVGTPSLNPLIYTLRNKEVTRAFRRLLGKEM | |
100 μg | |
Olfactory | |
7932 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Mouse | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction