OR2K2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP183189

Catalog No. NBP183189

Description

OR2K2 Polyclonal specifically detects OR2K2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: OR2K2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: HSHTPCRH06, HTPCRH06OR2AN1P, MGC133152, olfactory receptor 2K2, Olfactory receptor OR9-17, olfactory receptor, family 2, subfamily AN, member 1 pseudogene, olfactory receptor, family 2, subfamily AR, member 1 pseudogene, olfactory receptor, family 2, subfamily K, member 2, OR2AR1P
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 26248
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: OR2K2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TLYSFLYVLRLNEGNSTGRNIDERKKMQGENFTIWSIFFLEGFSQYPGLEV
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only