OR2L2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP309770100UL

Catalog No. NB124441

Description

OR2L2 Polyclonal specifically detects OR2L2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: OR2L2
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: HSHTPCRH07, HTPCRH07OR1-48, Olfactory receptor 2L12, olfactory receptor 2L2, Olfactory receptor 2L4, olfactory receptor OR1-48 pseudogene, olfactory receptor, family 2, subfamily L, member 12, olfactory receptor, family 2, subfamily L, member 2, olfactory receptor, family 2, subfamily L, member 4 pseudogene, OR2L12, OR2L4P
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR2L2 (NP_001004686). Peptide sequence HLTVVSFYYAPFAYTYVRPRSLRSPTEDKILAVFYTILTPMLNPIIYSLR
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 26246
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.