Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR2L8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | OR2L8 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
OR2L8 Polyclonal specifically detects OR2L8 in Human samples. It is validated for Western Blot.Specifications
OR2L8 | |
Polyclonal | |
Rabbit | |
NP_001001963 | |
391190 | |
The immunogen for this antibody is OR2L8. Peptide sequence TYLRPRSLRSPTEDKVLAVFYTILTPMLNPIIYSLRNKEVMGALTRVSQR. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
olfactory receptor 2L8, Olfactory receptor OR1-46, olfactory receptor, family 2, subfamily L, member 8 | |
OR2L8 | |
IgG | |
35 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title