Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR3A3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | OR3A3 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
OR3A3 Polyclonal specifically detects OR3A3 in Human samples. It is validated for Western Blot.Specifications
| OR3A3 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| Olfactory receptor 17-201, olfactory receptor 3A3, Olfactory receptor 3A6, Olfactory receptor 3A7, Olfactory receptor 3A8, Olfactory receptor OR17-22, olfactory receptor, family 3, subfamily A, member 3, olfactory receptor, family 3, subfamily A, member 6, olfactory receptor, family 3, subfamily A, member 7, olfactory receptor, family 3, subfamily A, member 8 pseudogene, OR17-137, OR17-16, OR17-201OR3A6, OR3A7, OR3A8P | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR3A3 (NP_036505). Peptide sequence MRLGSVESSDKDKGVGVFMTVINPMLNPLIYSLRNTDVQGALCQLLVGKR | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 8392 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title