OR4D1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP309782100UL

Catalog No. NB124465

Description

OR4D1 Polyclonal specifically detects OR4D1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: OR4D1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: olfactory receptor 4D1, Olfactory receptor 4D3, olfactory receptor OR17-23 pseudogene, Olfactory receptor TPCR16, olfactory receptor, family 4, subfamily D, member 1, olfactory receptor, family 4, subfamily D, member 3, olfactory receptor, family 4, subfamily D, member 4 pseudogene, OR17-23, OR4D3, OR4D4P, seven transmembrane helix receptor, TPCR16
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR4D1. Peptide sequence LLLISYTVILVMLRSHSGKARRKAASTCTTHIIVVSMIFIPCIYIYTWPF
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 26689
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.