Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR52A5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | OR52A5 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
OR52A5 Polyclonal specifically detects OR52A5 in Human samples. It is validated for Western Blot.Specifications
| OR52A5 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| Odorant receptor HOR3'beta5, olfactory receptor 52A5, Olfactory receptor OR11-33, olfactory receptor, family 52, subfamily A, member 5, OR11-33 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR52A5 (NP_001005160). Peptide sequence IRVNKIYGLFVAFAILGFDIIFITLSYVQIFITVFQLPQKEARFKAFNTC | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 390054 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title