Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR52B2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$106.19 - $352.89
Specifications
| Antigen | OR52B2 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Conjugate | Unconjugated |
| Format | Purified |
Description
OR52B2 Polyclonal specifically detects OR52B2 in Human samples. It is validated for Western Blot.Specifications
| OR52B2 | |
| Western Blot | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 255725 | |
| Polyclonal | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Unconjugated | |
| Rabbit | |
| Human | |
| olfactory receptor 52B2, Olfactory receptor OR11-70, olfactory receptor, family 52, subfamily B, member 2, OR11-70 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR52B2 (NP_001004052). Peptide sequence LDVILIAVSYSLILRAVFRLPSQDARHKALSTCGSHLCVILMFYVPSFFT | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title