Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR52N5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | OR52N5 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
OR52N5 Polyclonal specifically detects OR52N5 in Human samples. It is validated for Western Blot.Specifications
OR52N5 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
olfactory receptor 52N5, Olfactory receptor OR11-62, olfactory receptor, family 52, subfamily N, member 5, OR11-62, OR52N5Q | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR52N5 (NP_001001922). Peptide sequence GHTIPPSLHIIVANLYLLLPPTLNPIVYGVKTKQIRKSVIKFFQGDKGAG | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
390075 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title