Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR5M10 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | OR5M10 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB124539
|
Novus Biologicals
NBP309819100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
OR5M10 Polyclonal specifically detects OR5M10 in Human samples. It is validated for Western Blot.Specifications
OR5M10 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
olfactory receptor 5M10, olfactory receptor, family 5, subfamily M, member 10, OR11-207 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR5M10 (NP_001004741). Peptide sequence SAEGRHKAFSTCASHLTIVTLFYGTLFCMYVRPPSEKSVEESKIIAVFYT | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
390167 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title