Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR6C75 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | OR6C75 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
OR6C75 Polyclonal specifically detects OR6C75 in Human samples. It is validated for Western Blot.Specifications
OR6C75 | |
Polyclonal | |
Rabbit | |
A6NL08 | |
390323 | |
Synthetic peptides corresponding to OR6C75(olfactory receptor, family 6, subfamily C, member 75) The peptide sequence was selected from the middle region of OR6C75. Peptide sequence SCIFMYIKTSARERVTLSKGVAVLNTSVAPLLNPFIYTLRNKQVKQAFKS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
olfactory receptor 6C75, olfactory receptor, family 6, subfamily C, member 75 | |
OR6C75 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title