Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Orc2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25650325UL
Description
Orc2 Polyclonal specifically detects Orc2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
Orc2 | |
Polyclonal | |
Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
ORC2Lorigin recognition complex subunit 2, origin recognition complex protein 2 homolog, origin recognition complex, subunit 2, origin recognition complex, subunit 2 (yeast homolog)-like, origin recognition complex, subunit 2 homolog, origin recognition complex, subunit 2 homolog (yeast), origin recognition complex, subunit 2-like, origin recognition complex, subunit 2-like (yeast) | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
ORC2 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MLEVHFVGDDDVLNHILDREGGAKLKKERAQLLVNPKKIIKKPEYDLEEDDQEVLKDQNYVEIMGRDVQESLKNGSATGGGNKVYSFQNRKHSEKMAK | |
25 μL | |
Cell Cycle and Replication | |
4999 | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction