Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ORC4L Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen ORC4L
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP158167
View Documents
Novus Biologicals
NBP158167
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

ORC4L Polyclonal specifically detects ORC4L in Human samples. It is validated for Western Blot.
Specifications

Specifications

ORC4L
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
HsORC4, ORC4LFLJ46668, ORC4P, origin recognition complex subunit 4, origin recognition complex, subunit 4, origin recognition complex, subunit 4 (yeast homolog)-like, origin recognition complex, subunit 4 homolog, origin recognition complex, subunit 4 homolog (S. cerevisiae), origin recognition complex, subunit 4-like, origin recognition complex, subunit 4-like (S. cerevisiae), origin recognition complex, subunit 4-like (yeast)
ORC4
IgG
Affinity Purified
This product is specific to Subunit or Isoform: 4.
Western Blot
Unconjugated
RUO
O43929
5000
Synthetic peptides corresponding to ORC4L(origin recognition complex, subunit 4-like (yeast)) The peptide sequence was selected from the middle region of ORC4L. Peptide sequence VLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVV.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit