Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Orexin R1/HCRTR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
$382.00 - $610.00
Specifications
Antigen | Orexin R1/HCRTR1 |
---|---|
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Orexin R1/HCRTR1 Polyclonal specifically detects Orexin R1/HCRTR1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Orexin R1/HCRTR1 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
hypocretin (orexin) receptor 1, hypocretin receptor 1, Hypocretin receptor type 1, hypocretin receptor-1, orexin receptor 1, orexin receptor type 1, orexin receptor-1, ox1-R, Ox1R, Ox-1-R | |
HCRTR1 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Polyclonal | |
Rabbit | |
Cancer, GPCR, Neuronal Cell Markers, Neuroscience | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
3061 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWV | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title