Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ORP8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15981420UL
Description
ORP8 Polyclonal specifically detects ORP8 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
ORP8 | |
Polyclonal | |
Western Blot 1:100-1:2000, Immunohistochemistry | |
Q68D75 | |
OSBPL8 | |
Synthetic peptides corresponding to OSBPL8(oxysterol binding protein-like 8) The peptide sequence was selected from the N terminal of OSBPL8. Peptide sequence SQRQGKEAYPTPTKDLHQPSLSPASPHSQGFERGKEDISQNKDESSLSMS. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot, Immunohistochemistry | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
MGC126578, MGC133203, MST120, MSTP120, ORP-8, ORP8KIAA1451, OSBP10DKFZp686A11164, OSBP-related protein 8, oxysterol binding protein-like 8, oxysterol-binding protein-related protein 8 | |
Rabbit | |
Affinity Purified | |
RUO | |
114882 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction