Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Osteocalcin Antibody (190125) [DyLight 405], Novus Biologicals™

Mouse Monoclonal Antibody
Supplier: Novus Biologicals FAB1419E
Description
Osteocalcin Monoclonal antibody specifically detects Osteocalcin in Human, Rat samples. It is validated for Immunohistochemistry, Flow Cytometry (Intracellular Staining), Immunocytochemistry, CyTOFSpecifications
Osteocalcin | |
Monoclonal | |
DyLight 405 | |
50mM Sodium Borate | |
Mouse | |
Protein A or G purified from hybridoma culture supernatant | |
RUO | |
Primary | |
Human, Rat | |
Purified |
Immunohistochemistry, Flow Cytometry (Intracellular Staining), Immunocytochemistry, CyTOF | |
190125 | |
Immunohistochemistry, Intracellular Staining by Flow Cytometry, Immunocytochemistry, CyTOF-ready | |
BGP, bone gamma-carboxyglutamate (gla) protein, bone gamma-carboxyglutamate (gla) protein (osteocalcin), Bone Gla protein, Gamma-carboxyglutamic acid-containing protein, OC, OCN, osteocalcin | |
Human Osteocalcin synthetic peptide, YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV, Accession # P02818 | |
0.1 mL | |
Extracellular Matrix, Stem Cell Markers | |
632 | |
Store at 4°C in the dark. | |
IgG1 |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction