Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP159190

Osteopontin/OPN Antibody, Novus Biologicals™
SDP

Catalog No. NBP159190 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159190 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159190 Supplier Novus Biologicals Supplier No. NBP159190
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Osteopontin/OPN Polyclonal specifically detects Osteopontin/OPN in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen Osteopontin/OPN
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 4-8 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P10451-2
Gene Alias BNSP, Bone sialoprotein 1, MGC110940, Nephropontin, osteopontin, secreted phosphoprotein 1bone sialoprotein I, early T-lymphocyteactivation 1), secreted phosphoprotein-1 (osteopontin, bone sialoprotein), SPP-1, SPP1/CALPHA1 fusion, Urinary stone protein, uropontin
Gene Symbols SPP1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SPP1 (secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1)) The peptide sequence was selected from the C terminal of SPP1 (NP_000573). Peptide sequence DSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASS The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 33 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, Cellular Markers, Extracellular Matrix, Hypoxia
Primary or Secondary Primary
Gene ID (Entrez) 6696
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Goat, Sheep
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.