Otubain-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB418825	Novus Biologicals NBP18367025UL	25 μL
NBP183670	Novus Biologicals NBP183670	0.1 mL

Description

Otubain-1 Polyclonal specifically detects Otubain-1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: Otubain-1
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human, Mouse, Rat
• Gene Alias: Deubiquitinating enzyme OTUB1, EC 3.1.2, EC 3.4.19.12, FLJ20113, FLJ40710, hOTU1, MGC111158, OTB1MGC4584, OTU domain, ubiquitin aldehyde binding 1, OTU domain-containing ubiquitin aldehyde-binding protein 1, OTU1OTU-domain Ubal-binding 1, otubain-1, ubiquitin thioesterase OTUB1, ubiquitin-specific protease otubain 1, Ubiquitin-specific-processing protease OTUB1
• Gene Symbols: OTUB1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of human Otubain-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Proteases & Other Enzymes
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 55611
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:AAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRKTRPD
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only