Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OTUD6A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | OTUD6A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
OTUD6A Polyclonal specifically detects OTUD6A in Human samples. It is validated for Western Blot.Specifications
OTUD6A | |
Polyclonal | |
Rabbit | |
Human | |
DUBA2, DUBA-2, OTU domain containing 6A | |
OTUD6A | |
IgG | |
32 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_997203 | |
139562 | |
Synthetic peptide directed towards the N terminal of human OTUD6A. Peptide sequence MEAEMAQKHRQELEKFQDDSSIESVVEDLAKMNLENRPPRSSKAHRKRER. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title