Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OTUD7B/Cezanne/ZA20D1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | OTUD7B/Cezanne/ZA20D1 |
---|---|
Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
OTUD7B/Cezanne/ZA20D1 Polyclonal specifically detects OTUD7B/Cezanne/ZA20D1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
OTUD7B/Cezanne/ZA20D1 | |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human, Mouse, Rat | |
cellular zinc finger NF-kappaB Cezanne, Cellular zinc finger NF-kappa-B protein, CEZANNEA20 domain containing 1, EC 3.4.19.12, OTU domain containing 7B, OTU domain-containing protein 7B, ZA20D1, Zinc finger A20 domain-containing protein 1, Zinc finger protein Cezanne | |
OTUD7B | |
IgG | |
Affinity Purified | |
Specificity of human OTUD7B/Cezanne/ZA20D1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Rabbit | |
Mucosal Immunology | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
56957 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:PHQDSIPSLEPGSHSKDGLHRGALLPPPYRVADSYSNGYREPPEPDGWAGGLRGLPPTQTKCKQPNCSFYG | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title