Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579777

Invitrogen™ OTX2 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579777
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579777 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579777 Supplier Invitrogen™ Supplier No. PA579777
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: COLO320 whole cell.

OTX2 is a 289 amino acid containing protein encoding a member of the bicoid sub-family of homeodomain-containing transcription factors. It has two known alternative splice variants with distinct isoforms though presence of other isoforms cannot be excluded. The protein is an early marker of endodermal differentiation of embryonic stem cells and may play a role in the development of the brain and the sensory organs. The proteinmay bind to BCD target sequence (BTS): 5-'TCTAATCCC-3'. Defects in OTX2 are the cause of microphthalmia syndromic type 5 (MCOPS5).
TRUSTED_SUSTAINABILITY

Specifications

Antigen OTX2
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene OTX2
Gene Accession No. P32243
Gene Alias CPHD6; E130306E05Rik; homeobox Otx2; homeobox protein OTX2; MCOPS5; orthodenticle homeobox 2; orthodenticle homolog 2; OTX; OTX2
Gene Symbols OTX2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Otx2 (258-289aa DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5015
Target Species Human
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.