OVCA1 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP156693	100 μL

Catalog No. NBP156693 Supplier Novus Biologicals Supplier No. NBP156693

Description

Rabbit Polyclonal Antibody

OVCA1 Polyclonal specifically detects OVCA1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: OVCA1
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: Q9BZG8
• Gene Alias: Diphthamide biosynthesis protein 2 homolog-like 1, Diphthamide biosynthesis protein 2-like, diptheria toxin resistance protein required for diphthamide biosynthesis(Saccharomyces)-like 1, diptheria toxin resistance protein required for diphthamide biosynthesis-like 1, diptheria toxin resistance protein required for diphthamide biosynthesis-like 1(S. cerevisiae), DPH1 homolog, DPH1 homolog (S. cerevisiae), DPH2L, DPH2L1diphthamide biosynthesis protein 1, DPH2-like 1, DPH-like 1, DPH-like 1 (S. cerevisiae), FLJ33211, hsDph1, Ovarian cancer-associated gene 1 protein, ovarian tumor suppressor candidate 1, OVCA1candidate tumor suppressor in ovarian cancer 1
• Gene Symbols: DPH1
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to DPH1(DPH1 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of DPH1. Peptide sequence RMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFV.
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1801
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Xenopus: 92%; Rat: 92%; Zebrafish: 92%; Chicken: 85%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG