Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OVGP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$610.00
Specifications
Antigen | OVGP1 |
---|---|
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
OVGP1 Polyclonal specifically detects OVGP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
OVGP1 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
5016 | |
This antibody was developed against a recombinant protein corresponding to amino acids: GTHPRMGNLGLQMEAENRMMLSSSPVIQLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDE | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Rabbit | |
Human | |
CHIT5, EGP, Estrogen-dependent oviduct protein, MUC9, mucin 9, mucin-9, OGP, oviduct glycoprotein, Oviductal glycoprotein, oviductal glycoprotein 1, 120kDa, oviductin, oviduct-specific glycoprotein | |
OVGP1 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title