Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

OXCT1 Antibody, Novus Biologicals™
SDP

Catalog No. NB395740 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB395740 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB395740 Supplier Novus Biologicals Supplier No. NBP24933125UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

OXCT1 Polyclonal antibody specifically detects OXCT1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

Antigen OXCT1
Applications Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias 3-oxoacid CoA transferase 1,3-oxoacid CoA transferase, EC 2.8.3, EC 2.8.3.5, SCOTmitochondrial
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: ATWYKGCVCSFSTSAHRHTKFYTDPVEAVKDIPDGA
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer, Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5019
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.