Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OXCT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00
Specifications
Antigen | OXCT1 |
---|---|
Dilution | Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 |
Applications | Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
OXCT1 Polyclonal antibody specifically detects OXCT1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
OXCT1 | |
Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Cancer, Endocrinology, Signal Transduction | |
PBS (pH 7.2), 40% Glycerol | |
5019 | |
IgG | |
Immunogen affinity purified |
Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
Polyclonal | |
Purified | |
RUO | |
Human | |
3-oxoacid CoA transferase 1,3-oxoacid CoA transferase, EC 2.8.3, EC 2.8.3.5, SCOTmitochondrial | |
This antibody was developed against a recombinant protein corresponding to amino acids: ATWYKGCVCSFSTSAHRHTKFYTDPVEAVKDIPDGA | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title