OXSM Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB406877	Novus Biologicals NBP18473025UL	25ul
NBP184730	Novus Biologicals NBP184730	0.1 mL

Description

OXSM Polyclonal specifically detects OXSM in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: OXSM
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: 3-ketoacyl-acyl carrier protein synthase, 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial, 3-oxoacyl-ACP synthase, mitochondrial, acyl-malonyl acyl carrier protein-condensing enzyme, beta-ketoacyl synthase, Beta-ketoacyl-ACP synthase, EC 2.3.1, EC 2.3.1.41, FASN2D, FLJ20604, KASI, KS3-oxoacyl-acyl-carrier-protein synthase, type II mitochondrial beta-ketoacyl synthase
• Gene Symbols: OXSM
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: metabolism
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 54995
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SSTKGATGHLLGAAGAVEAAFTTLACYYQKLPPTLNLDCSEPEFDLNYVPLKAQEWKTEKRFIGLTNSFGFGGTNATLCIAGL
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only