p15INK4b/CDKN2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23802325UL

Catalog No. NB396995

Description

p15INK4b/CDKN2B Polyclonal specifically detects p15INK4b/CDKN2B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: p15INK4b/CDKN2B
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: P42772
• Gene Symbols: CDKN2B
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAG
• Quantity: 25 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 1030
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CDK4I, cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4), cyclin-dependent kinases 4 and 6 binding protein, INK4BCDK4B inhibitor, MTS-2, MTS2CDK inhibitory protein, Multiple tumor suppressor 2, p14_CDK inhibitor, p14_INK4B, p14-INK4b, p15 CDK inhibitor, p15_INK4B, P15cyclin-dependent kinase 4 inhibitor B, p15INK4b, p15-INK4b, TP15
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.