Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
p15INK4b/CDKN2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP238023
Description
p15INK4b/CDKN2B Polyclonal specifically detects p15INK4b/CDKN2B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
p15INK4b/CDKN2B | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
P42772 | |
CDKN2B | |
This antibody was developed against a recombinant protein corresponding to amino acids: MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAG | |
0.1 mL | |
Cell Cycle and Replication | |
1030 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CDK4I, cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4), cyclin-dependent kinases 4 and 6 binding protein, INK4BCDK4B inhibitor, MTS-2, MTS2CDK inhibitory protein, Multiple tumor suppressor 2, p14_CDK inhibitor, p14_INK4B, p14-INK4b, p15 CDK inhibitor, p15_INK4B, P15cyclin-dependent kinase 4 inhibitor B, p15INK4b, p15-INK4b, TP15 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction