p23/PTGES3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB406557	Novus Biologicals NBP18548525UL	25 μL
NBP185485	Novus Biologicals NBP185485	0.1 mL

Description

p23/PTGES3 Polyclonal specifically detects p23/PTGES3 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: p23/PTGES3
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human, Mouse, Rat
• Gene Alias: cPGESp23, Cytosolic prostaglandin E2 synthase, Hsp90 co-chaperone, P23cytosolic prostaglandin E synthase, Progesterone receptor complex p23, prostaglandin E synthase 3, prostaglandin E synthase 3 (cytosolic), TEBPEC 5.3.99.3, Telomerase-binding protein p23, unactive progesterone receptor, 23 kD
• Gene Symbols: PTGES3
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of human p23/PTGES3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Membrane Trafficking and Chaperones
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 10728
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:CVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLT
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only