P2X3/P2RX3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NBP233848	Novus Biologicals NBP233848	0.1 mL

Description

P2X3/P2RX3 Polyclonal specifically detects P2X3/P2RX3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: P2X3/P2RX3
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: P56373
• Gene ID (Entrez): 5024
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFAGQDFAKLARTGGVLGIKIGWVCDLDKAWDQCIPKY
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Signal Transduction
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ATP receptor, MGC129956, P2X purinoceptor 3, P2X receptor, subunit 3, P2X3purinergic receptor P2X3, Purinergic receptor, purinergic receptor P2X, ligand-gated ion channel, 3, purinoceptor P2X3
• Gene Symbols: P2RX3
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only